1. Science
  2. Biology
  3. how do i calculate the alignment length from this blastp...

Question: how do i calculate the alignment length from this blastp...

Question details
How do I calculate the alignment length from this Blastp search?

To compare the lengths of the query and the subject. Is it just 138-60 = 78 so 78 are aligned?
Download GenPept Graphics YBR062C-like protein [Saccharomyces kudriavzevi IFO 1802] Sequence ID: gil4018422221EJT44473.1 Length: 102 Number of Matches: 1 ▼ Next Match ▲ Previous Match Range 1: 1 to 102 GenPept Graphics Score Positives Gaps 0/ 102(096) Expect Identities 206 bits(525) 4e-66 Query 79 MDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLEC 138 sbjct 1 MDKGKNTGCPDSPAASLPRINRKKLNSTDNCSICYTNYLEDEYPLVVELPHCNHRFDLEC 60 Query 139 LSvwLsRSTTCPLCRDNVMGERI INE IDTTEAELEEDİGMYG 180 Sbjct 61 LSWLSRSTTCPLCRDDVMGHRİ İNDIDTNEAELEEDWGMYG 102 917102(8996) 99/102(9796) MDKGK+ GCPD+FAASLPRIN+KKL +TDNCSICYTNYLEDEYPLVVELPHC+H+FDLEC LSVWLSRSTTCPLCRD+VMGHRIIN+IDT EAELEEDWGMYG
Solution by an expert tutor
Blurred Solution
This question has been solved
Subscribe to see this solution