Question: how do i calculate the alignment length from this blastp...
Question details
How do I calculate the alignment length from this Blastp
search?
To compare the lengths of the query and the subject. Is it
just 138-60 = 78 so 78 are aligned?
![Download GenPept Graphics YBR062C-like protein [Saccharomyces kudriavzevi IFO 1802] Sequence ID: gil4018422221EJT44473.1 Length: 102 Number of Matches: 1 ▼ Next Match ▲ Previous Match Range 1: 1 to 102 GenPept Graphics Score Positives Gaps 0/ 102(096) Expect Identities 206 bits(525) 4e-66 Query 79 MDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLEC 138 sbjct 1 MDKGKNTGCPDSPAASLPRINRKKLNSTDNCSICYTNYLEDEYPLVVELPHCNHRFDLEC 60 Query 139 LSvwLsRSTTCPLCRDNVMGERI INE IDTTEAELEEDİGMYG 180 Sbjct 61 LSWLSRSTTCPLCRDDVMGHRİ İNDIDTNEAELEEDWGMYG 102 917102(8996) 99/102(9796) MDKGK+ GCPD+FAASLPRIN+KKL +TDNCSICYTNYLEDEYPLVVELPHC+H+FDLEC LSVWLSRSTTCPLCRD+VMGHRIIN+IDT EAELEEDWGMYG](https://homework-api-assets-production.s3.ap-southeast-2.amazonaws.com/uploads/store/926806322/1604922670c43308cecd16253415e6ae7b4d787c5c.png)
Solution by an expert tutor
